DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and rab2a

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_002936157.1 Gene:rab2a / 100038062 XenbaseID:XB-GENE-479011 Length:211 Species:Xenopus tropicalis


Alignment Length:213 Identity:190/213 - (89%)
Similarity:198/213 - (92%) Gaps:2/213 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQ 65
            |:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog     1 MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQ 65

  Fly    66 EAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVK 130
            |:||||||||||||||||||||||||:|||||||||||||||||||||||||.|||||:||||||
 Frog    66 ESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIANKSDLESRREVK 130

  Fly   131 KEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTN 195
            |||||||||||||:||||||:||:||||||||||||||||||||||||||||||||||.|||  .
 Frog   131 KEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHS--T 193

  Fly   196 PSLPGAGGAAGAANSGCC 213
            |..||:......|..|||
 Frog   194 PGSPGSHLGGQQAGGGCC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 188/211 (89%)
rab2aXP_002936157.1 PLN03108 1..199 CDD:178655 185/199 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 298 1.000 Domainoid score I1437
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20628
Inparanoid 1 1.050 332 1.000 Inparanoid score I2389
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271975at2759
OrthoFinder 1 1.000 - - FOG0002747
OrthoInspector 1 1.000 - - oto104625
Panther 1 1.100 - - LDO PTHR47979
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3432
SonicParanoid 1 1.000 - - X1831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.