DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab2 and si:dkey-34d22.2

DIOPT Version :9

Sequence 1:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001186990.2 Gene:si:dkey-34d22.2 / 100005807 ZFINID:ZDB-GENE-131127-261 Length:183 Species:Danio rerio


Alignment Length:182 Identity:70/182 - (38%)
Similarity:106/182 - (58%) Gaps:4/182 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITID-GKQIKLQIWDTAGQEAF 68
            |.||.|:|||...||||::.::.:..|:.: |.|||::|.|:.:.:: |..:.||||||.|.|.|
Zfish     2 YHFKIIMIGDNATGKSCMMYRYRNGCFKHM-DCTIGMDFCAKSLEMEPGVNVNLQIWDTPGHERF 65

  Fly    69 RSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNS-NMVIMLIGNKSDLDSRREVKKE 132
            .....:|...:||.|||:|:..|||||.:.......|..::. :::.:|:|||.| ...|||.:|
Zfish    66 WDAILAYIPRSAGCLLVFDLGNRETFNFIKFRYSAVRTKAHPYSVLFVLVGNKCD-SEEREVSQE 129

  Fly   133 EGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANG 184
            |.|.||.|.|..::||||:|..||.|||....:.||:.:..|...::....|
Zfish   130 EVEEFASEVGAPYIETSAKTGHNVTEAFELLTRHIYQGLISGELHLHESCIG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 70/182 (38%)
si:dkey-34d22.2NP_001186990.2 RAB 4..166 CDD:197555 66/163 (40%)
Rab 4..162 CDD:206640 65/159 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.