DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob4 and MOB1

DIOPT Version :9

Sequence 1:NP_001246151.1 Gene:Mob4 / 35576 FlyBaseID:FBgn0259483 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_012160.2 Gene:MOB1 / 854700 SGDID:S000001368 Length:314 Species:Saccharomyces cerevisiae


Alignment Length:238 Identity:59/238 - (24%)
Similarity:105/238 - (44%) Gaps:35/238 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KMADGSTILRRNRPGTKS----KDFCRWP--DEPL--EEMDSTLAVQQYIQQLIKRDPSNVELI- 57
            :|:...|..:|:.|..:.    .||...|  .:|.  .:..:|:...|.|:|:::....:..:: 
Yeast    78 RMSPVLTTPKRHAPPPEQLQNVTDFNYTPSHQKPFLQPQAGTTVTTHQDIKQIVEMTLGSEGVLN 142

  Fly    58 --LTMPEAQDEGVWKYEHLRQFCMELNGLAVRLQKECSPSTCTQMTATDQWIFLCAAHK--TPKE 118
              :.:|..:||..|...|...|..::|.|...:.:.|||.||.:|.||:::.:|.|..|  .|..
Yeast   143 QAVKLPRGEDENEWLAVHCVDFYNQINMLYGSITEFCSPQTCPRMIATNEYEYLWAFQKGQPPVS 207

  Fly   119 CPAIDYTRHTLDGAACLL-------NSNKYFPSSVSPRVSIKESSVTK-LGSVCRRVYRIFSHAY 175
            ..|..|..       ||:       :....|||.|:.  :..|..:.: :..:.||::|:::|.|
Yeast   208 VSAPKYVE-------CLMRWCQDQFDDESLFPSKVTG--TFPEGFIQRVIQPILRRLFRVYAHIY 263

  Fly   176 FHHRRIFDEFEAETYLCHRFTHFVTKYNLMSKE-NLIVPINVG 217
            .||.....|...:|.|...|.||.    |.::| .|:.|.:.|
Yeast   264 CHHFNEILELNLQTVLNTSFRHFC----LFAQEFELLRPADFG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob4NP_001246151.1 Mob1_phocein 53..211 CDD:397617 44/171 (26%)
MOB1NP_012160.2 Mob1_phocein 134..304 CDD:397617 47/182 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.