DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob4 and MOB2

DIOPT Version :9

Sequence 1:NP_001246151.1 Gene:Mob4 / 35576 FlyBaseID:FBgn0259483 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_116618.1 Gene:MOB2 / 850508 SGDID:S000001859 Length:287 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:41/202 - (20%)
Similarity:80/202 - (39%) Gaps:65/202 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LIKRDPSNVELILTMPEAQDEGVWKYEHLRQFCMELNGLAVRLQKECSPSTCTQMTATDQWIFLC 110
            |:|   .:.:.|:.:|:..|.|.|...::.:|...||                      |:..:.
Yeast   105 LVK---GSFKTIVQLPKYVDLGEWIALNVFEFFTNLN----------------------QFYGVV 144

  Fly   111 AAHKTPKECPAIDYTRHT----LDGAACLLNSNKYFPSS---------VSPRVSIKESSVTKLG- 161
            |.:.||...|.::...||    ||..    |.....|:|         ::.:|:.|....||.| 
Yeast   145 AEYVTPDAYPTMNAGPHTDYLWLDAN----NRQVSLPASQYIDLALTWINNKVNDKNLFPTKNGL 205

  Fly   162 -----------SVCRRVYRIFSHAYFHHRRIFDE---FEAETYLCHRFTHFVT---KYNLMSKEN 209
                       .:..:::|||:|.|.||   ||:   ...|.:....|:||::   ::.::.::.
Yeast   206 PFPQQFSRDVQRIMVQMFRIFAHIYHHH---FDKIVHLSLEAHWNSFFSHFISFAKEFKIIDRKE 267

  Fly   210 L--IVPI 214
            :  ::|:
Yeast   268 MAPLLPL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob4NP_001246151.1 Mob1_phocein 53..211 CDD:397617 38/190 (20%)
MOB2NP_116618.1 Mob1_phocein 102..271 CDD:397617 40/197 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.