DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob4 and mob4

DIOPT Version :9

Sequence 1:NP_001246151.1 Gene:Mob4 / 35576 FlyBaseID:FBgn0259483 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001017210.1 Gene:mob4 / 549964 XenbaseID:XB-GENE-948291 Length:225 Species:Xenopus tropicalis


Alignment Length:229 Identity:181/229 - (79%)
Similarity:198/229 - (86%) Gaps:6/229 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKMADGSTILRRNRPGTKSKDFCRWPDEPLEEMDSTLAVQQYIQQLIKRDPSNVELILTMPEAQD 65
            |.||:|:.:|||||||||::||..||||..|||||||||||||||.|:.|.||::.||..||.||
 Frog     1 MVMAEGTVVLRRNRPGTKAQDFYNWPDESFEEMDSTLAVQQYIQQNIRTDCSNIDRILDPPEGQD 65

  Fly    66 EGVWKYEHLRQFCMELNGLAVRLQKECSPSTCTQMTATDQWIFLCAAHKTPKECPAIDYTRHTLD 130
            |||||||||||||:|||||||:||.||.|.||||||||:||||||||||||||||||||||||||
 Frog    66 EGVWKYEHLRQFCLELNGLAVKLQTECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLD 130

  Fly   131 GAACLLNSNKYFPSSVSPRVSIKESSVTKLGSVCRRVYRIFSHAYFHHRRIFDEFEAETYLCHRF 195
            ||||||||||||||    |||||||||.||||||||:||||||||||||:||||:|.||:|||||
 Frog   131 GAACLLNSNKYFPS----RVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRF 191

  Fly   196 THFVTKYNLMSKENLIVPINVGE--NAAPGESEA 227
            |.||.|||||||:||||||...|  |:..|||||
 Frog   192 TKFVMKYNLMSKDNLIVPILEEEVQNSVAGESEA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob4NP_001246151.1 Mob1_phocein 53..211 CDD:397617 132/157 (84%)
mob4NP_001017210.1 Mob1_phocein 53..207 CDD:397617 132/157 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 284 1.000 Domainoid score I1611
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9116
Inparanoid 1 1.050 372 1.000 Inparanoid score I2076
OMA 1 1.010 - - QHG56926
OrthoDB 1 1.010 - - D1229701at2759
OrthoFinder 1 1.000 - - FOG0006943
OrthoInspector 1 1.000 - - oto102915
Panther 1 1.100 - - LDO PTHR22599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2908
SonicParanoid 1 1.000 - - X5035
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.