DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob4 and mob4

DIOPT Version :9

Sequence 1:NP_001246151.1 Gene:Mob4 / 35576 FlyBaseID:FBgn0259483 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001003439.1 Gene:mob4 / 445045 ZFINID:ZDB-GENE-040801-174 Length:225 Species:Danio rerio


Alignment Length:229 Identity:179/229 - (78%)
Similarity:197/229 - (86%) Gaps:6/229 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKMADGSTILRRNRPGTKSKDFCRWPDEPLEEMDSTLAVQQYIQQLIKRDPSNVELILTMPEAQD 65
            |.||:|:.:|||||||||:|||..|.||..|||||||||||||||.|:.|.||:|.|:..||.||
Zfish     1 MVMAEGTAVLRRNRPGTKAKDFYNWSDESFEEMDSTLAVQQYIQQNIRSDCSNIEKIMEPPEGQD 65

  Fly    66 EGVWKYEHLRQFCMELNGLAVRLQKECSPSTCTQMTATDQWIFLCAAHKTPKECPAIDYTRHTLD 130
            |||||||||||||:|||||||:||.||.|.||||||||:||||||||||||||||||||||||||
Zfish    66 EGVWKYEHLRQFCLELNGLAVKLQNECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLD 130

  Fly   131 GAACLLNSNKYFPSSVSPRVSIKESSVTKLGSVCRRVYRIFSHAYFHHRRIFDEFEAETYLCHRF 195
            ||||||||||||||    |||||||||.||||||||:||||||||||||:|||::|.||:|||||
Zfish   131 GAACLLNSNKYFPS----RVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDKYENETFLCHRF 191

  Fly   196 THFVTKYNLMSKENLIVPINVGE--NAAPGESEA 227
            |.||.|||||||:||||||...|  :|..|||:|
Zfish   192 TRFVMKYNLMSKDNLIVPILEEEVQSATAGESDA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob4NP_001246151.1 Mob1_phocein 53..211 CDD:397617 131/157 (83%)
mob4NP_001003439.1 Mob1_phocein 53..207 CDD:397617 131/157 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580622
Domainoid 1 1.000 291 1.000 Domainoid score I1501
eggNOG 1 0.900 - - E1_KOG1852
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9116
Inparanoid 1 1.050 376 1.000 Inparanoid score I2053
OMA 1 1.010 - - QHG56926
OrthoDB 1 1.010 - - D1229701at2759
OrthoFinder 1 1.000 - - FOG0006943
OrthoInspector 1 1.000 - - oto39290
orthoMCL 1 0.900 - - OOG6_104515
Panther 1 1.100 - - LDO PTHR22599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2908
SonicParanoid 1 1.000 - - X5035
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.