DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob4 and mob1bb

DIOPT Version :9

Sequence 1:NP_001246151.1 Gene:Mob4 / 35576 FlyBaseID:FBgn0259483 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_999948.2 Gene:mob1bb / 407654 ZFINID:ZDB-GENE-050522-58 Length:216 Species:Danio rerio


Alignment Length:189 Identity:43/189 - (22%)
Similarity:82/189 - (43%) Gaps:20/189 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EPLEEMDSTLAVQQYIQQLIKRDPSNVELILTMPEAQDEGVWKYEHLRQFCMELNGLAVRLQKEC 92
            |.|:..::||.            ..|:.:.:.:||.:|...|...:...|..::|.|...:...|
Zfish    27 ELLKHAEATLG------------SGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFC 79

  Fly    93 SPSTCTQMTATDQWIFLCAAH---KTPKECPAIDYTRHTLDGAACLLNSNKYFPSSVSPRVSIKE 154
            |..:|..|:|..::.:..|..   |.|.:|.|..:..:.:......|:....|||.:........
Zfish    80 SEDSCPVMSAGPKYEYHWADGTNIKKPIKCSAPKFIDYLMTWVQDQLDDETLFPSKIGVPFPKNF 144

  Fly   155 SSVTKLGSVCRRVYRIFSHAYFHHRRIFDEFEAETYLCHRFTH---FVTKYNLMSKENL 210
            .||.|  ::.:|::|:::|.|..|.....:.:.|.:|...|.|   ||.::||:.::.|
Zfish   145 MSVAK--TILKRLFRVYAHIYHQHFDAVMQLQEEAHLNTSFKHFIFFVQEFNLIDRKEL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob4NP_001246151.1 Mob1_phocein 53..211 CDD:397617 39/164 (24%)
mob1bbNP_999948.2 Mob1_phocein 33..204 CDD:281617 41/183 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.