DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob4 and Mob2

DIOPT Version :9

Sequence 1:NP_001246151.1 Gene:Mob4 / 35576 FlyBaseID:FBgn0259483 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_729715.2 Gene:Mob2 / 39293 FlyBaseID:FBgn0259481 Length:728 Species:Drosophila melanogaster


Alignment Length:212 Identity:44/212 - (20%)
Similarity:80/212 - (37%) Gaps:39/212 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RRNRPGTKSKDFCRWPDEPLEEMDSTLAVQQYIQQLIKRDPSNVELILTMPEAQDEGVWKYEHLR 75
            |:.|.|.::            ..|:.|.:::.:.:. |...::::.::.:|...|...|...|..
  Fly   303 RKERDGDQN------------STDTKLYLEESVLER-KLPEADLKALVDLPAGLDYNEWLASHTL 354

  Fly    76 QFCMELNGLAVRLQKECSPSTCTQMTATDQWIFLCAAHKTPKECPA----IDY----TRHTLDGA 132
            .....:|.:...:.:.|:.|.|..||......:|....|..|...|    |||    |:.|:...
  Fly   355 ALFEHVNLVYGTISEFCTQSGCADMTGPGNRTYLWFDEKGKKTRVAAPQYIDYVMTFTQKTVSDE 419

  Fly   133 ACLLNSNKY---FPSSVSPRVSIKESSVTKLGSVCRRVYRIFSHAYFHHRRIFDEFEAETYLCHR 194
            :  :...||   ||.|.       ||...|   :.|..:.:.:|.|..|.|........|:|...
  Fly   420 S--IFPTKYANEFPGSF-------ESIARK---ILRLQFHVIAHLYAAHFREIALLGLHTHLNLT 472

  Fly   195 FTHFVT---KYNLMSKE 208
            |.|...   ::||:.::
  Fly   473 FAHLTALHRRFNLIDEK 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob4NP_001246151.1 Mob1_phocein 53..211 CDD:397617 38/170 (22%)
Mob2NP_729715.2 Mob1_phocein 328..494 CDD:281617 38/174 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.