DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob4 and Mob3

DIOPT Version :9

Sequence 1:NP_001246151.1 Gene:Mob4 / 35576 FlyBaseID:FBgn0259483 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_609364.1 Gene:Mob3 / 34372 FlyBaseID:FBgn0259482 Length:220 Species:Drosophila melanogaster


Alignment Length:167 Identity:41/167 - (24%)
Similarity:79/167 - (47%) Gaps:14/167 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NVELILTMPEAQDEGVWKYEHLRQFCMELNGLAVRLQKECSPSTCTQMTATDQWIFLCA---AHK 114
            |:..::.:|:.::...|...|:..|...:|.:...:.:.|:.:||..|:...::.:|.|   .:|
  Fly    44 NLRQVVRLPQGENLNDWLAVHVVDFFNRINLIYGTVSEFCNETTCPTMSGGSRYEYLWADGDLYK 108

  Fly   115 TPKECPAIDYTRHTLDGAACLLNSNKYFPSSVSPRVSIKESSVTKLGSVCRRVYRIFSHAYFHHR 179
            .|....|..|..|.:|.....:|:...||  ||..|...::.:.....:..|::|:|.|.|.|| 
  Fly   109 KPTALSAQKYIEHLMDWIETQINNEAVFP--VSTDVPFPKNFIAISRKILTRLFRVFVHVYIHH- 170

  Fly   180 RIFDEF-----EAETYLCHR-FTHFVTKYNLMSKENL 210
              ||..     ||....|:: |.:||.:::::|.:.|
  Fly   171 --FDRIVSIGAEAHVNACYKHFYYFVQEFDMISAKEL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob4NP_001246151.1 Mob1_phocein 53..211 CDD:397617 41/167 (25%)
Mob3NP_609364.1 Mob1_phocein 36..208 CDD:281617 41/167 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.