DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob4 and mob1

DIOPT Version :9

Sequence 1:NP_001246151.1 Gene:Mob4 / 35576 FlyBaseID:FBgn0259483 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_595191.1 Gene:mob1 / 2540845 PomBaseID:SPBC428.13c Length:210 Species:Schizosaccharomyces pombe


Alignment Length:205 Identity:47/205 - (22%)
Similarity:83/205 - (40%) Gaps:27/205 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LRRNRPGTKSKDFCRWPDEPLEEMDSTLAVQQYIQQLIKRDPSNVELILTMPEAQDEGVWKYEHL 74
            :|:...|||.....::.:..|.......||:                   :|:.:|...|...:.
pombe    14 VRKTEAGTKHYQLRQYAEATLGSGSLMEAVK-------------------LPKGEDLNEWIAMNT 59

  Fly    75 RQFCMELNGLAVRLQKECSPSTCTQMTATDQWIFLCAAHK---TPKECPAIDYTRHTLDGAACLL 136
            ..|..::|.|...:.:.|:.::|.||.|...:.:.....|   .|....|.||..:.||.....|
pombe    60 MDFYTQINMLYGTITEFCTAASCPQMNAGPSYEYYWQDDKIYTKPTRMSAPDYINNLLDWTQEKL 124

  Fly   137 NSNKYFPSSVSPRVSIKESSVTKLGSVCRRVYRIFSHAYFHHRRIFDEFEAETYLCHRFTHFV-- 199
            :..|.||:.:.  |...::....:..:.||::||::|.|..|..:....|.|:||...|.|||  
pombe   125 DDKKLFPTEIG--VEFPKNFRKVIQQIFRRLFRIYAHIYCSHFHVMVAMELESYLNTSFKHFVFF 187

  Fly   200 -TKYNLMSKE 208
             .::.||..:
pombe   188 CREFGLMDNK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob4NP_001246151.1 Mob1_phocein 53..211 CDD:397617 40/162 (25%)
mob1NP_595191.1 Mob1_phocein 31..202 CDD:281617 43/188 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.