DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob4 and mob2

DIOPT Version :9

Sequence 1:NP_001246151.1 Gene:Mob4 / 35576 FlyBaseID:FBgn0259483 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_587851.1 Gene:mob2 / 2539016 PomBaseID:SPCC970.04c Length:244 Species:Schizosaccharomyces pombe


Alignment Length:190 Identity:41/190 - (21%)
Similarity:76/190 - (40%) Gaps:27/190 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YIQQ------LIKRDPSNVELILTMPEAQDEGVWKYEHLRQFCMELNGLAVRLQKECSPSTCTQM 100
            |:||      |:|   .|...|:::|...|...|...::.:....||.........|:..||..|
pombe    55 YLQQPFVRTHLVK---GNFSTIVSLPRFVDLDEWVALNVYELFTYLNHFYDVFATFCTVKTCPVM 116

  Fly   101 TATDQ----WIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSSVSPRVSIKESSVTKLG 161
            :|...    |:   ..::.|...||..|..:.|......|:....||:...  :....:.:..:.
pombe   117 SAAANFDYTWL---DNNRKPVHLPAPQYIEYVLAWIENRLHDQNVFPTKAG--LPFPSNFLVIVK 176

  Fly   162 SVCRRVYRIFSHAYFHHRRIFDEFEAETYLCHRFTHFVT---KYNLMSK------ENLIV 212
            ::.::::|||:|.|:.|.........|.:....|.||:.   ::.|:.|      ::|||
pombe   177 AIYKQMFRIFAHMYYAHYAEILHLSLEAHWNSFFAHFIAFGKEFQLLDKRDTAPLKDLIV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob4NP_001246151.1 Mob1_phocein 53..211 CDD:397617 33/170 (19%)
mob2NP_587851.1 Mob1_phocein 65..231 CDD:281617 35/173 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.