DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob4 and AgaP_AGAP002066

DIOPT Version :9

Sequence 1:NP_001246151.1 Gene:Mob4 / 35576 FlyBaseID:FBgn0259483 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_320981.3 Gene:AgaP_AGAP002066 / 1281047 VectorBaseID:AGAP002066 Length:215 Species:Anopheles gambiae


Alignment Length:165 Identity:38/165 - (23%)
Similarity:78/165 - (47%) Gaps:10/165 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NVELILTMPEAQDEGVWKYEHLRQFCMELNGLAVRLQKECSPSTCTQMTATDQWIFLCAAHKT-- 115
            |:...:.:|:.:|...|...:...|..::|.|...:.:.|:..||:.|:|..::.:..|..:|  
Mosquito    38 NLRNAVQLPDGEDLNEWVAVNTVDFFNQINMLYGTITEFCTEDTCSIMSAGPKYEYHWADGQTVK 102

  Fly   116 -PKECPAIDYTRHTLDGAACLLNSNKYFPSSVSPRVSIKESSVTKLGSVCRRVYRIFSHAYFHH- 178
             |.:|.|..|..:.:......|:....|||.:.  |...::.:....::.:|::|:::|.|..| 
Mosquito   103 KPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIG--VPFPKNFINIAKTILKRLFRVYAHIYHQHF 165

  Fly   179 ---RRIFDEFEAETYLCHRFTHFVTKYNLMSKENL 210
               .|:.:|....|...| |.:||.::||:.:..|
Mosquito   166 SEVVRLSEEAHLNTSFKH-FIYFVQEFNLIDRREL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob4NP_001246151.1 Mob1_phocein 53..211 CDD:397617 38/165 (23%)
AgaP_AGAP002066XP_320981.3 Mob1_phocein 32..202 CDD:397617 38/165 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.