DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob4 and MOB3A

DIOPT Version :9

Sequence 1:NP_001246151.1 Gene:Mob4 / 35576 FlyBaseID:FBgn0259483 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_570719.1 Gene:MOB3A / 126308 HGNCID:29802 Length:217 Species:Homo sapiens


Alignment Length:210 Identity:46/210 - (21%)
Similarity:83/210 - (39%) Gaps:34/210 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RRNRPGTKSKDFCRWPDEPLEE-MDSTLAVQQYIQQLIKRDPSNVELILTMPEAQDEGVWKYEHL 74
            |:..|||:..:..:.....|.. :|..||||                   :|..:|...|...|:
Human    20 RKFEPGTQRFELHKKAQASLNAGLDLRLAVQ-------------------LPPGEDLNDWVAVHV 65

  Fly    75 RQFCMELNGLAVRLQKECSPSTCTQMTATDQWIFLCA-AHK--TPKECPAIDYTRHTLDGAACLL 136
            ..|...:|.:...:...|:..:|..|:...::.:... .||  .|....|..|....:|.....:
Human    66 VDFFNRVNLIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQI 130

  Fly   137 NSNKYFPSSVSPRVSIKESSVTKLGSVCRRVYRIFSHAYFHHRRIFDEF-----EAETYLCHR-F 195
            |:...||::|.  ....::.:..:..:..|::|:|.|.|.||   ||..     ||....|:: |
Human   131 NNEDLFPTNVG--TPFPKNFLQTVRKILSRLFRVFVHVYIHH---FDRIAQMGSEAHVNTCYKHF 190

  Fly   196 THFVTKYNLMSKENL 210
            .:||.::.|:..:.|
Human   191 YYFVKEFGLIDTKEL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob4NP_001246151.1 Mob1_phocein 53..211 CDD:397617 36/167 (22%)
MOB3ANP_570719.1 Mob1_phocein 36..208 CDD:397617 42/194 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.