DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob4 and mob3c

DIOPT Version :9

Sequence 1:NP_001246151.1 Gene:Mob4 / 35576 FlyBaseID:FBgn0259483 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_002931452.1 Gene:mob3c / 100494365 XenbaseID:XB-GENE-975743 Length:216 Species:Xenopus tropicalis


Alignment Length:218 Identity:44/218 - (20%)
Similarity:86/218 - (39%) Gaps:39/218 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NRPGTKSKDFCRWPDEPLEEMDSTLAVQQYIQQLIKRDPSNVEL--ILTMPEAQDEGVWKYEHLR 75
            |:...|.|.|  .|.:..|.......:.:..|..:|   |.::|  ::.:|..::...|...|:.
 Frog     6 NQVFNKDKTF--RPRKKFEPGTQRFELYKKAQASLK---SGLDLKTVVQLPPGENINDWIAVHVV 65

  Fly    76 QFCMELNGLAVRLQKECSPSTCTQMTATDQWIFLCAA------------HKTPKECPAIDYTRHT 128
            .|...:|.:...:.:.|:..:|.         .:|..            :|.|.:..|..|....
 Frog    66 DFFNRINLIYGTMSEFCTERSCP---------IMCGGLKYEYRWQDDNKYKRPTKVSAPLYMNML 121

  Fly   129 LDGAACLLNSNKYFPSSVSPRVSIKESSVTKLGSVCRRVYRIFSHAYFHHRRIFDEF-----EAE 188
            ::....|:|:...||:.:.  |...::.......:..|::|:|.|.|.||   ||..     ||.
 Frog   122 MEWIETLINNEDIFPTRMG--VPFPKNFQQVCNKILTRLFRVFVHVYIHH---FDAIISVGAEAH 181

  Fly   189 TYLCHR-FTHFVTKYNLMSKENL 210
            ...|:: |.:|:|:::|:....|
 Frog   182 VNTCYKHFYYFITEFSLVDHREL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob4NP_001246151.1 Mob1_phocein 53..211 CDD:397617 35/178 (20%)
mob3cXP_002931452.1 Mob1_phocein 35..207 CDD:367587 38/187 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.