DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp25 and AT1G76010

DIOPT Version :9

Sequence 1:NP_001246150.1 Gene:Rpp25 / 35574 FlyBaseID:FBgn0033092 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001319386.1 Gene:AT1G76010 / 843932 AraportID:AT1G76010 Length:350 Species:Arabidopsis thaliana


Alignment Length:231 Identity:59/231 - (25%)
Similarity:92/231 - (39%) Gaps:54/231 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KAENVEKELSKSDLPFEDCMPKSQKDFLWMHVKGGTKVSNVIEFAQEAL-NKGEHRCVVWSGSGG 69
            |.:.|.|  .|:|.|.         |...:.:....:..|.|.:|...| :||... ||:...|.
plant     3 KYQRVVK--PKADTPI---------DANEIRITSQGRARNYITYAMTLLQDKGSTE-VVFKAMGR 55

  Fly    70 GVVKTISCAEVLKRSHP-LYQVTRMAYTSVEEHWKPQMEGLEEIIVTRQIPTLHILMSLDELPDT 133
            .:.||::..|::||..| |:|.|.:..|.:.:.|:|..|||..:..||.:..:.|.:|..||..:
plant    56 AINKTVTIVELIKRRIPDLHQNTSIGSTDITDTWEPTEEGLLPLETTRHVSMITITLSKIELNTS 120

  Fly   134 IDGLQ--------KPNTSTDFWDGGGAQQQPHPRSQPR--------------------------- 163
            ..|.|        ||....|:   .|.:..|..|.:.|                           
plant   121 SVGYQCPIPIELVKPMGDIDY---EGREGSPGGRGRGRGRGRGRGRGRGGRGNAYVNVEHEDGGW 182

  Fly   164 HQQQPHKPGAGRG-GRPNK-RTRPGRNKPGQQPEKP 197
            .::|.:..|.||| ||.:: |.|.|.|.|..:.:.|
plant   183 EREQSYGRGRGRGRGRSSRGRGRGGYNGPPNEYDAP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp25NP_001246150.1 Alba 34..97 CDD:280153 18/64 (28%)
AT1G76010NP_001319386.1 Alba 19..83 CDD:396481 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2567
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075123at2759
OrthoFinder 1 1.000 - - FOG0002040
OrthoInspector 1 1.000 - - otm2792
orthoMCL 1 0.900 - - OOG6_101937
Panther 1 1.100 - - O PTHR13516
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1508
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.