DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp25 and AT1G20220

DIOPT Version :9

Sequence 1:NP_001246150.1 Gene:Rpp25 / 35574 FlyBaseID:FBgn0033092 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_564108.1 Gene:AT1G20220 / 838610 AraportID:AT1G20220 Length:315 Species:Arabidopsis thaliana


Alignment Length:195 Identity:53/195 - (27%)
Similarity:84/195 - (43%) Gaps:34/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KAENVEKELSKSDLPFEDCMPKSQKDFLWMHVKGGTKVSNVIEFAQEALNKGEHRCVVWSGSGGG 70
            |.:.|||  .|:|.|..:..         :.:....:..|.|.:|...|.:.:...|::...|..
plant     3 KYQRVEK--PKADTPIAENE---------IRITSMGRARNYITYAMALLQENKSNEVIFKAMGRA 56

  Fly    71 VVKTISCAEVLKRSHP-LYQVTRMAYTSVEEHWKPQMEGLEEIIVTRQIPTLHILMSLDELPDTI 134
            :.|:::..|::||..| |:|:|.:..|.:.:.|:|..|||:.|..||.:..:.|.:|.::|..:.
plant    57 INKSVTIVELIKRRIPGLHQITSIGSTDITDTWEPTEEGLQTIETTRHVSMITITLSKEQLNTSS 121

  Fly   135 DGLQ--------KPNTSTDFWDGGGAQQQPHPRSQPRHQQQPHKPGAGRGGRPNKRTRPGR-NKP 190
            .|.|        ||....|:   .|....|..|...|          |||||...|.|.|| |.|
plant   122 VGYQCPIPIEMVKPLAEIDY---EGQDGSPRGRGGRR----------GRGGRGRGRGRGGRGNGP 173

  Fly   191  190
            plant   174  173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp25NP_001246150.1 Alba 34..97 CDD:280153 14/63 (22%)
AT1G20220NP_564108.1 Alba 19..83 CDD:280153 14/72 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2567
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075123at2759
OrthoFinder 1 1.000 - - FOG0002040
OrthoInspector 1 1.000 - - otm2792
orthoMCL 1 0.900 - - OOG6_101937
Panther 1 1.100 - - O PTHR13516
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1508
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.