DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp25 and RPP25

DIOPT Version :9

Sequence 1:NP_001246150.1 Gene:Rpp25 / 35574 FlyBaseID:FBgn0033092 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_060263.2 Gene:RPP25 / 54913 HGNCID:30361 Length:199 Species:Homo sapiens


Alignment Length:196 Identity:63/196 - (32%)
Similarity:91/196 - (46%) Gaps:39/196 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PFEDCMPKSQKDFLWMHVKGGTKVSNVIEFAQEALNKGEHRCVVWSGSGGGVVKTISCAEVLKRS 84
            ||.|..|.:    :.|.||.|:|:.|::.||..::.:...|.:|:||.|....||::|||:|||.
Human    27 PFADLAPGA----VHMRVKEGSKIRNLMAFATASMAQPATRAIVFSGCGRATTKTVTCAEILKRR 87

  Fly    85 -HPLYQVTRMAYTSVEEHWKPQMEG----------LEEIIVTRQIPTLHILMSLDELPDTIDGLQ 138
             ..|:||||:.|.||.|.|:....|          ...:.|.:.:|.|.||:|.|.|.....|.|
Human    88 LAGLHQVTRLRYRSVREVWQSLPPGPTQGQTPGEPAASLSVLKNVPGLAILLSKDALDPRQPGYQ 152

  Fly   139 KPNTSTDFWDGGGAQQQPH-----PRSQPRHQQQPHKPGAGRGGRPNKRTRPGRNKPGQQPEKPA 198
            .||              ||     |.:.|..::...:|.||.|..  ||::|   :||...|...
Human   153 PPN--------------PHPGPSSPPAAPASKRSLGEPAAGEGSA--KRSQP---EPGVADEDQT 198

  Fly   199 A 199
            |
Human   199 A 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Rpp25NP_001246150.1 Alba 34..97 CDD:280153 27/63 (43%)