DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp25 and Rpp25l

DIOPT Version :9

Sequence 1:NP_001246150.1 Gene:Rpp25 / 35574 FlyBaseID:FBgn0033092 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001100118.1 Gene:Rpp25l / 298002 RGDID:1306576 Length:163 Species:Rattus norvegicus


Alignment Length:197 Identity:65/197 - (32%)
Similarity:92/197 - (46%) Gaps:43/197 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMHYRKAENVEKELSKSDLPFEDCMPKSQKDFLWMHVKGGTKVSNVIEFAQEALNKGEHRCVVWS 65
            |.|||:|.:||       ||....||:...|.|.|.|:.|:|:.|::..|...|..|..|.||:|
  Rat     1 MEHYRRAGSVE-------LPASSPMPQLPPDTLEMRVRDGSKIRNLLGLALARLEGGSTRHVVFS 58

  Fly    66 GSGGGVVKTISCAEVLKRSHP-LYQVTRMAYTSVEEHWKPQM--EGLEEIIVTRQIPTLHILMSL 127
            |||....|.:||||::||..| |:|:|::.:...|:.|.|..  .||:.:.|.|.:|.:.:|:|.
  Rat    59 GSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPTSPDTGLDPLTVRRHVPAVWVLLSR 123

  Fly   128 DELPDTIDGLQKPNTSTDFWDGGGAQQQPHPRSQPRHQQQPHKPGAGR------GGRPNKRTRPG 186
            |.|..:..|.|.|          ||                 .||.|.      |.||.:|.|..
  Rat   124 DPLDPSECGYQPP----------GA-----------------PPGLGSIPSSSCGPRPRRRARDT 161

  Fly   187 RN 188
            |:
  Rat   162 RS 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp25NP_001246150.1 Alba 34..97 CDD:280153 26/63 (41%)
Rpp25lNP_001100118.1 Alba 27..89 CDD:396481 26/61 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340108
Domainoid 1 1.000 55 1.000 Domainoid score I10863
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41714
Inparanoid 1 1.050 94 1.000 Inparanoid score I4975
OMA 1 1.010 - - QHG45569
OrthoDB 1 1.010 - - D1075123at2759
OrthoFinder 1 1.000 - - FOG0002040
OrthoInspector 1 1.000 - - otm45016
orthoMCL 1 0.900 - - OOG6_101937
Panther 1 1.100 - - LDO PTHR13516
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1508
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.