DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp25 and ZK632.14

DIOPT Version :9

Sequence 1:NP_001246150.1 Gene:Rpp25 / 35574 FlyBaseID:FBgn0033092 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001023013.1 Gene:ZK632.14 / 259525 WormBaseID:WBGene00014020 Length:206 Species:Caenorhabditis elegans


Alignment Length:194 Identity:52/194 - (26%)
Similarity:81/194 - (41%) Gaps:27/194 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PFEDCMPKSQKDFLWMHVKGGTKVSNVIEFAQEALNKGE--HRCVVWSGSGGGVVKTISCAEVLK 82
            ||.  .|.:..|...|.|...:|.:.:....::...:..  :|.||:..:.|...|.:||.||.|
 Worm    17 PFP--APYNTADAKIMLVSKSSKFTKINGHVRDYFTESPDCNRFVVFKSTNGATEKAVSCVEVFK 79

  Fly    83 R--SHPLYQVTRMAYTSVEEHWKPQMEGLEEIIVTRQIPTLHILMSLDELPDTIDGLQKPNTSTD 145
            :  ..||||.||:..:.....||...||..:|.||.::|.:.|::|.|..|.....:.. ..|:|
 Worm    80 QQFEEPLYQWTRVVCSKRIVLWKCLQEGPRDIRVTVEVPVIFIVISRDPFPGEYSCMSM-QCSSD 143

  Fly   146 ----FWDGGGAQQQPHPRSQPRHQQQPHKPGAGRGGRPNKRTRPGRN--KPG-QQPEKPAAEEN 202
                |.          |..:..|..:..|.|..:|   |::|..|..  ||. :|.:|...|.|
 Worm   144 KDIAFL----------PVIRTSHGGKADKKGEKKG---NRKTNEGNKWMKPNTEQRKKENKERN 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp25NP_001246150.1 Alba 34..97 CDD:280153 19/66 (29%)
ZK632.14NP_001023013.1 Alba 28..92 CDD:376663 18/63 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158917
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2567
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002040
OrthoInspector 1 1.000 - - oto19555
orthoMCL 1 0.900 - - OOG6_101937
Panther 1 1.100 - - LDO PTHR13516
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5028
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.730

Return to query results.
Submit another query.