DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp25 and rpp25b

DIOPT Version :9

Sequence 1:NP_001246150.1 Gene:Rpp25 / 35574 FlyBaseID:FBgn0033092 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001338628.1 Gene:rpp25b / 101885168 ZFINID:ZDB-GENE-170530-4 Length:335 Species:Danio rerio


Alignment Length:225 Identity:64/225 - (28%)
Similarity:98/225 - (43%) Gaps:51/225 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YRKAENVEKELSKSDLPFEDCMPKSQKDFLWMHVKGGTKVSNVIEFAQEALNKGEH-RCVVWSGS 67
            :::...:|.||.   .||    |......|.|.||.|:|:.|::.|:...:..|.. |.||:|||
Zfish    17 FKRVCRLEDELC---CPF----PNLTAGVLEMRVKEGSKIRNLMGFSMARMQDGAALRQVVFSGS 74

  Fly    68 GGGVVKTISCAEVLKRSHP-LYQVTRMAYTSVEEHWKPQMEGLEEIIVTRQIPTLHILMSLDELP 131
            |..|.|||:|||::||..| |:|::::.|..:.|.|:.|..|..::.|.|.:|::.||:|.|.|.
Zfish    75 GRAVTKTITCAEIMKRKMPGLHQISKLQYRGLREVWESQDRGDAQVTVHRTLPSISILLSKDPLD 139

  Fly   132 DTIDGLQKPNTSTDFWDGGGAQ---------QQP------------HPRSQPRHQQQPH------ 169
            ....|.|.|....|..:.|...         .||            .|...|:|...|.      
Zfish   140 PLEPGYQPPEDHQDLLEPGNQSLKQDLLEPGYQPLKDTKDLLEPGYQPLKSPKHLLDPRFQVIKD 204

  Fly   170 -----KPGAGRGGRPNKRTRPGRNKPGQQP 194
                 :||          ::|.:|:.|..|
Zfish   205 PKNLLEPG----------SQPPKNQDGLDP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp25NP_001246150.1 Alba 34..97 CDD:280153 28/64 (44%)
rpp25bNP_001338628.1 Alba 40..103 CDD:307849 27/62 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579957
Domainoid 1 1.000 54 1.000 Domainoid score I11219
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075123at2759
OrthoFinder 1 1.000 - - FOG0002040
OrthoInspector 1 1.000 - - otm24520
orthoMCL 1 0.900 - - OOG6_101937
Panther 1 1.100 - - O PTHR13516
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1508
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.