DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp25 and rpp25

DIOPT Version :9

Sequence 1:NP_001246150.1 Gene:Rpp25 / 35574 FlyBaseID:FBgn0033092 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_017947889.2 Gene:rpp25 / 100496900 XenbaseID:XB-GENE-990186 Length:173 Species:Xenopus tropicalis


Alignment Length:147 Identity:45/147 - (30%)
Similarity:84/147 - (57%) Gaps:10/147 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMHYRKAENVEKELSKSDLPFEDCMPKSQKDFLWMHVKGGTKVSNVIEFAQEALNKGEHRCVVWS 65
            |.::|:.:.|::: ....|||::..|    |.:.|.||.|:|:.|::.:|...:...|:..:|:|
 Frog     1 MENFRRVQVVDED-DGQPLPFKNLHP----DVVKMRVKEGSKIRNLVGYAVTHMLSEENGQIVFS 60

  Fly    66 GSGGGVVKTISCAEVLKRS-HPLYQVTRMAYTSVEEHWK---PQME-GLEEIIVTRQIPTLHILM 125
            ..|.||.|.::|.|:|||. ..|:|||::.|..|:|.|:   |::: ....:.|.:..|:::||:
 Frog    61 AYGRGVTKAVTCVEILKRKIGGLHQVTKVQYKIVQEVWEQKGPKVQHPAPRLNVQKNYPSINILL 125

  Fly   126 SLDELPDTIDGLQKPNT 142
            |.:.|....:|.|.|.:
 Frog   126 SKEPLDPQEEGYQPPQS 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp25NP_001246150.1 Alba 34..97 CDD:280153 24/63 (38%)
rpp25XP_017947889.2 Alba 30..93 CDD:396481 24/62 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11629
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I4989
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075123at2759
OrthoFinder 1 1.000 - - FOG0002040
OrthoInspector 1 1.000 - - otm48075
Panther 1 1.100 - - O PTHR13516
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1508
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.