DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp25 and rpp25l

DIOPT Version :9

Sequence 1:NP_001246150.1 Gene:Rpp25 / 35574 FlyBaseID:FBgn0033092 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001107352.1 Gene:rpp25l / 100135176 XenbaseID:XB-GENE-5793607 Length:183 Species:Xenopus tropicalis


Alignment Length:185 Identity:61/185 - (32%)
Similarity:97/185 - (52%) Gaps:19/185 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KELSKSDLPFEDCMPKSQKDFLWMHVKGGTKVSNVIEFAQEALNKGEHRCVVWSGSGGGVVKTIS 76
            |::..:::|....:|....|.:.|.|:.|:|:.|::.||...:.:...|.:|:||||..:.||||
 Frog     5 KKVGVAEVPMAVPIPGLPPDTIEMKVRDGSKMRNLLGFAIGQMERQATRQIVFSGSGKALGKTIS 69

  Fly    77 CAEVLKRS-HPLYQVTRMAYTSVEEHWKPQME--GLEEIIVTRQIPTLHILMSLDELPDTIDGLQ 138
            |||::||. ..|:|:||:.:...:|.|:|.:.  ||:.:.|.|..|::.||:|.|.|.....|.|
 Frog    70 CAEIMKRRLGGLHQLTRVCFRQTQETWEPIVPDVGLDPLTVRRNCPSVCILLSKDPLDPAEPGYQ 134

  Fly   139 KPNTSTDFWDGGGAQQ--QPHPRSQPR--------HQQQPHKPGAGRGGRPNKRT 183
            .|.:....|    .||  :..||.:.|        ..:||..||...||  :|||
 Frog   135 APGSYDTHW----VQQLREETPRQKRRGTGRAGGDGTKQPRGPGGPGGG--HKRT 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp25NP_001246150.1 Alba 34..97 CDD:280153 26/63 (41%)
rpp25lNP_001107352.1 Alba 27..89 CDD:376663 26/61 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11629
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I4989
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002040
OrthoInspector 1 1.000 - - otm48075
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1508
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.