DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp25 and rpp25a

DIOPT Version :9

Sequence 1:NP_001246150.1 Gene:Rpp25 / 35574 FlyBaseID:FBgn0033092 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001338627.1 Gene:rpp25a / 100000532 ZFINID:ZDB-GENE-061215-1 Length:204 Species:Danio rerio


Alignment Length:173 Identity:54/173 - (31%)
Similarity:88/173 - (50%) Gaps:18/173 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KELSKSDLPFEDCMPKSQKDFLWMHVKGGTKVSNVIEFAQEALNKGEHRCVVWSGSGGGVVKTIS 76
            :::..:..|..:.:|....|.|.|.||.|:|:.|::.||...:.......|::||:|..|.|||:
Zfish    35 RKIRSTGEPIPNPIPGLASDVLEMRVKEGSKIRNLLGFAMSRIEGDGQTQVLFSGTGRAVTKTIT 99

  Fly    77 CAEVLKRS-HPLYQVTRMAYTSVEEHWKPQMEGLEEIIVTRQIPTLHILMSLDELPDTIDGLQKP 140
            |||::||. ..|:||:::.|.:|.|.|:.|.   .::.|.|.:|::.||:|.:.|.....|.|.|
Zfish   100 CAEIMKRKVAGLHQVSKLQYRTVTEVWESQE---SQMTVHRTLPSICILLSKEPLDPHEPGYQPP 161

  Fly   141 ---NTSTDFW---DG--GGAQQQPHPRSQPRHQQQPHKPGAGR 175
               ||.::..   ||  |..:.:..|.|...|      ||..|
Zfish   162 VETNTLSEEHRQVDGVQGSGKTEKRPLSPCDH------PGLKR 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp25NP_001246150.1 Alba 34..97 CDD:280153 25/63 (40%)
rpp25aNP_001338627.1 Alba 57..121 CDD:307849 25/63 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579956
Domainoid 1 1.000 54 1.000 Domainoid score I11219
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5091
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1075123at2759
OrthoFinder 1 1.000 - - FOG0002040
OrthoInspector 1 1.000 - - otm24520
orthoMCL 1 0.900 - - OOG6_101937
Panther 1 1.100 - - O PTHR13516
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1508
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.