DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdc1 and AT2G28230

DIOPT Version :10

Sequence 1:NP_610226.2 Gene:Tdc1 / 35573 FlyBaseID:FBgn0259977 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_180390.2 Gene:AT2G28230 / 817369 AraportID:AT2G28230 Length:219 Species:Arabidopsis thaliana


Alignment Length:38 Identity:10/38 - (26%)
Similarity:20/38 - (52%) Gaps:10/38 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 PAKFNGRYVIRFCVTYEHATEKDILEAWTQIKCFAEEI 472
            |.|:  .::||        |::.:|||.:.|:...|::
plant    73 PNKY--YFIIR--------TQRIVLEADSSIQLIMEKL 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tdc1NP_610226.2 Pyridoxal_deC 35..412 CDD:395219
AT2G28230NP_180390.2 Med20 1..208 CDD:400779 10/38 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.