DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdc1 and GAD1

DIOPT Version :9

Sequence 1:NP_610226.2 Gene:Tdc1 / 35573 FlyBaseID:FBgn0259977 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_000808.2 Gene:GAD1 / 2571 HGNCID:4092 Length:594 Species:Homo sapiens


Alignment Length:439 Identity:110/439 - (25%)
Similarity:179/439 - (40%) Gaps:78/439 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EVIDYICQYGTNIEERDVAPTLDPGYLKKLLPA------DAPQSPEPFKDVLEDFEQKIMPGVVH 70
            ||:|.:..|.....:|. ...||..:..:||..      :....||..:.:|.|....:..| |.
Human   119 EVVDILLNYVRKTFDRS-TKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYG-VR 181

  Fly    71 WNHPKFFAYFPSGNSFPSVLGDMLSSAIGSIGFSWASCPAAAELETI-------VMNWYAKALGL 128
            ..||:||....:|.....:.|:.|:|...:..|::...|....:|.|       ::.|.:|    
Human   182 TGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWSSK---- 242

  Fly   129 PKAFVSDAPG-STGGGALQGSASECVLVSLITARARAISEL--KGQTSVHDSVFLPSLIAYASRE 190
                  |..| .:.|||:..      :.|::.||.:...|:  ||..:|      |.|:.:.|.:
Human   243 ------DGDGIFSPGGAISN------MYSIMAARYKYFPEVKTKGMAAV------PKLVLFTSEQ 289

  Fly   191 AHSSVEKA--------TKMALVKL----RIIDADEHGRMRVDLLRQAIQNDVNAGLTPFFVVATV 243
            :|.|::||        ..:.|:|.    :||.||...:     :.:|.|.    |..||:|.||.
Human   290 SHYSIKKAGAALGFGTDNVILIKCNERGKIIPADFEAK-----ILEAKQK----GYVPFYVNATA 345

  Fly   244 GTTGGCAFDDITEIGKVCRQVSSIWLHVDGAYAGNSFILPEMRVFSAGLEYADSFNTNPNKLLLT 308
            |||...|||.|.||..:|.:. ::|||||.|:.|...:..:.|....|:|.|:|...||:|::..
Human   346 GTTVYGAFDPIQEIADICEKY-NLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGV 409

  Fly   309 NFDASALWVRDVMNLKSALNVNPLYL---RHEHLTGVDYRHYGIPLSRRFRALKLWFVFRTYGIR 370
            ....||:.|::...|:....:...||   ..::....|.....|...|.....|.|.:::..|..
Human   410 LLQCSAILVKEKGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTV 474

  Fly   371 GLQEYIRNHMALAKKFEMLVRKDERFEVRNDVHLGLVCFRMRTGDEPNH 419
            |.:..|...:.||:.....::..|.||             |....||.|
Human   475 GFENQINKCLELAEYLYAKIKNREEFE-------------MVFNGEPEH 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tdc1NP_610226.2 Pyridoxal_deC 35..412 CDD:278699 99/407 (24%)
GAD1NP_000808.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Pyridoxal_deC 144..518 CDD:365998 103/413 (25%)
Substrate binding 190..192 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.