DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdc1 and Csad

DIOPT Version :9

Sequence 1:NP_610226.2 Gene:Tdc1 / 35573 FlyBaseID:FBgn0259977 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001346055.1 Gene:Csad / 246277 MGIID:2180098 Length:493 Species:Mus musculus


Alignment Length:419 Identity:120/419 - (28%)
Similarity:182/419 - (43%) Gaps:54/419 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VIDYICQYGTNIEERDVAPTLDPGYLKKLLPADAPQSPEPFKDVLEDFEQKIMPGVVHWN----H 73
            |:|.....||:..|: |....:|..||:||..:.....|..:.:||....     |:|::    |
Mouse    28 VVDEAILKGTSASEK-VCEWKEPEELKQLLDLELQSQGESREQILERCRT-----VIHYSVKTGH 86

  Fly    74 PKFFAYFPSGNSFPSVLGDMLSSAIGSIGFSWASCPAAAELETIVMNWYAKALGLPKAFVSDAPG 138
            |:||....||....::.|.:::.::.:..:::...|....:|..|:......:|.........||
Mouse    87 PRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLKKLRALVGWNSGDGVFCPG 151

  Fly   139 STGGGALQGSASECVLVSLITARARAISELKGQTSVHDSVFLPSLIAYASREAHSSVEKATK--- 200
                    ||.|....::|  ||.:...:.| |..:.   .||.|..:.|:|.|.|:.|...   
Mouse   152 --------GSISNMYAMNL--ARFQRYPDCK-QRGLR---ALPPLALFTSKECHYSITKGAAFLG 202

  Fly   201 MALVKLRIIDADEHGRM-RVDLLRQAIQNDVNAGLTPFFVVATVGTTGGCAFDDITEIGKVCRQV 264
            :....:|::.|||.||| ..||.||.|..:.. |..||.|.||.|||...|||.:..|..|| |.
Mouse   203 LGTDSVRVVKADERGRMIPEDLERQIILAEAE-GSVPFLVSATSGTTVLGAFDPLDAIADVC-QR 265

  Fly   265 SSIWLHVDGAYAGNSFILPEMRVFSAGLEYADSFNTNPNKLLLTNFDASALWVRDVMNLKSALNV 329
            ..:|.|||.|:.|:..:....|....|::.|||...||:|||......|||.:||..||      
Mouse   266 HGLWFHVDAAWGGSVLLSRTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLRDTSNL------ 324

  Fly   330 NPLYLRHEHLTGVDY-----RHYGIPL---------SRRFRALKLWFVFRTYGIRGLQEYIRNHM 380
                |:..|.:...|     :.|.:.|         .||...||||.:::..|.:||:..|....
Mouse   325 ----LKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGGQGLERRIDQAF 385

  Fly   381 ALAKKFEMLVRKDERFEVRNDVHLGLVCF 409
            ||.:.....::|.|.||:..:.....|||
Mouse   386 ALTRYLVEEIKKREGFELVMEPEFVNVCF 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tdc1NP_610226.2 Pyridoxal_deC 35..412 CDD:278699 114/397 (29%)
CsadNP_001346055.1 DOPA_deC_like 89..481 CDD:99743 102/352 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.