DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdc1 and Sepsecs

DIOPT Version :9

Sequence 1:NP_610226.2 Gene:Tdc1 / 35573 FlyBaseID:FBgn0259977 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_766078.1 Gene:Sepsecs / 211006 MGIID:1098791 Length:504 Species:Mus musculus


Alignment Length:177 Identity:39/177 - (22%)
Similarity:62/177 - (35%) Gaps:49/177 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 GLPKAFVSDAPGSTGGGALQGSASECVLVSLITARARAISELKGQTSVHDSVFLPSLIAYASREA 191
            |..:.|:.|......|.| ..|.|..||::|::.......:|..:..        .:..|.|.: 
Mouse   297 GFNEPFIQDISKMYPGRA-SASPSLDVLITLLSLGCSGYRKLLKERK--------EMFVYLSTQ- 351

  Fly   192 HSSVEKATKMALVKLRIIDADEHGRMRVDLLRQAIQNDVNAGLTPFFVVATVGTTGGCAFDDITE 256
                       |.||    |:.|.    :.|.|...|       |..:..|:.|..|.....:|:
Mouse   352 -----------LKKL----AEAHN----ERLLQTPHN-------PISLAMTLKTIDGHHDKAVTQ 390

  Fly   257 IGKV--CRQVSSIWLHVDGAYA---GNSFILPEMRVFSAGLEYADSF 298
            :|.:  .||||       ||.|   ||...: ....|...:.:||::
Mouse   391 LGSMLFTRQVS-------GARAVPLGNVQTV-SGHTFRGFMSHADNY 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tdc1NP_610226.2 Pyridoxal_deC 35..412 CDD:278699 39/177 (22%)
SepsecsNP_766078.1 Tetramerization. /evidence=ECO:0000269|PubMed:18093968 1..44
selenium_SpcS 13..458 CDD:211833 39/177 (22%)
Phosphate loop (P-loop). /evidence=ECO:0000269|PubMed:18093968 96..106
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.