DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdc1 and Sgpl1

DIOPT Version :9

Sequence 1:NP_610226.2 Gene:Tdc1 / 35573 FlyBaseID:FBgn0259977 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001303602.1 Gene:Sgpl1 / 20397 MGIID:1261415 Length:568 Species:Mus musculus


Alignment Length:503 Identity:108/503 - (21%)
Similarity:180/503 - (35%) Gaps:134/503 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GTNIEE------RDVAPTL-----DPGYLKKLLPADAPQSPEPFKDVLEDF-EQKIMPGVVHWNH 73
            |..||:      :|:...:     |..|: |.|||....:.|    |||.. |...|.|  .|..
Mouse    85 GRKIEQQVSKAKKDLVKNMPFLKVDKDYV-KTLPAQGMGTAE----VLERLKEYSSMDG--SWQE 142

  Fly    74 PKFFAYFPSG---NSFPSVLGDMLSSAIGSIGFSWAS------CPAAAELETIVMNWYAKALGLP 129
            .|     .||   |..|. |.::|..|.|.  |:|::      .|...:||       |:.:.:.
Mouse   143 GK-----ASGAVYNGEPK-LTELLVQAYGE--FTWSNPLHPDIFPGLRKLE-------AEIVRMT 192

  Fly   130 KAFVSDAPGSTGGGALQGSASECVLVSLITARARAISELKGQTSVHDSVFLPSLIAYASREAHSS 194
            .:..:..|.|.  |.:....:|.:|::....|..|:.  ||       :..|.::|..|  ||::
Mouse   193 CSLFNGGPDSC--GCVTSGGTESILMACKAYRDLALE--KG-------IKTPEIVAPES--AHAA 244

  Fly   195 VEKATKMALVKLRIIDADEHGRMRVDLLRQAIQNDVNAGLTPFFVVATVGTTGGCAFDDITEIGK 259
            .:||.....:|:..:...::..:.|..:::||..:     |...|.:|.....| ..|.:.|:.|
Mouse   245 FDKAAHYFGMKIVRVALKKNMEVDVQAMKRAISRN-----TAMLVCSTPQFPHG-VMDPVPEVAK 303

  Fly   260 VCRQVSSIWLHVDGAYAGNSFILPEMRVFSAGLEYADSFNTNPNKLLLTNFDASALWVRDVMNLK 324
            :..:. .|.||||....|  |::..|......||....|.                 |:.|.::.
Mouse   304 LAVRY-KIPLHVDACLGG--FLIVFMEKAGYPLEKPFDFR-----------------VKGVTSIS 348

  Fly   325 S--------------ALNVNPLYLRHEHLTGVDYRH--YGIPLSRRFR----ALKLWFVFRTYGI 369
            :              .:..|..|..::...|.|::.  |..|.....|    ....|.....:|.
Mouse   349 ADTHKYGYAPKGSSVVMYSNEKYRTYQFFVGADWQGGVYASPSIAGSRPGGIIAACWAALMHFGE 413

  Fly   370 RGLQEYIRNHMALAKKFEMLVRKDERFEVRN-----DVHLGLVCFRMRTGDEPNHMLLAQINHSG 429
            .|   |:.....:.|....|  |.|...::|     |..|.::.  :.:.|...:.|...::..|
Mouse   414 NG---YVEATKQIIKTARFL--KSELENIKNIFIFGDPQLSVIA--LGSNDFDIYRLSNMMSAKG 471

  Fly   430 KMHMTPAKFNGRYV-----IRFCVTYEHATE-------KDILEAWTQI 465
                    :|..|:     |.||:|..|..:       |||.|:.|||
Mouse   472 --------WNFNYLQFPRSIHFCITLVHTRKRVAIQFLKDIRESVTQI 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tdc1NP_610226.2 Pyridoxal_deC 35..412 CDD:278699 86/411 (21%)
Sgpl1NP_001303602.1 DOPA_deC_like 146..507 CDD:99743 85/424 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.