DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdc1 and gad3

DIOPT Version :9

Sequence 1:NP_610226.2 Gene:Tdc1 / 35573 FlyBaseID:FBgn0259977 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001083039.2 Gene:gad3 / 100038790 ZFINID:ZDB-GENE-070424-80 Length:546 Species:Danio rerio


Alignment Length:525 Identity:123/525 - (23%)
Similarity:205/525 - (39%) Gaps:95/525 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DVEEFRK-YGKEVIDYICQYGTNIEERDVAPTLDPGYLKKL------LPADAPQSPEPFKDVLED 59
            |.||..| :.:|:::.:..|.:...:|. ...||..|..:|      ...:.|..|:..:.:|.|
Zfish    60 DGEEATKHFLQELVNILLAYISKSLKRS-TKVLDFHYPHQLNEGLEGFSLELPDQPDNLEQLLVD 123

  Fly    60 FEQKIMPGVVHWNHPKFFAYFPSGNSFPSVLGDMLSSAIGSIGFSWASCPAAAELETIVMNWYAK 124
            ....:..| |...||:||....:|.....:.|:.|:|...:..|::...|....:|.:|:.....
Zfish   124 CRDTLKYG-VKTGHPRFFNQLSTGLDIVGLAGEWLTSTANTNMFTYEISPVFILMEEVVLRKMHT 187

  Fly   125 ALGLPKAFVSDAPGSTGGGALQGSASECVLVSLITARARAISELKGQTSVHDSVFLPSLIAYASR 189
            .:|.|:        ..|.|......|...|.|::.||......:|    .|....:|.|..:.|.
Zfish   188 IIGWPE--------EDGDGIFCPGGSMSNLYSVLLARFHLFPAVK----THGMCAIPRLAMFTSA 240

  Fly   190 EAHSSVEKATKMALV---KLRIIDADEHGRMRVDLLRQAIQNDVNAGLTPFFVVATVGTTGGCAF 251
            .:|.|::|:..:..:   .:.::..||.|:|....|..:|:...:.||.||:|.||.|||...||
Zfish   241 HSHYSIKKSAAVLGIGTENVIVVRCDERGKMISSELNSSIEEAKSKGLVPFYVNATAGTTVYGAF 305

  Fly   252 DDITEIGKVCRQVSSIWLHVDGAYAGNSFILPEMRVFSAGLEYADSFNTNPNKLLLTNFDASALW 316
            |.:.:|..:|.. ..:|:|||.|:.|...:..:.||...|:|.|.|...||:|::......|.:.
Zfish   306 DPLHKIADICEH-HGLWMHVDAAWGGGLLLSNKHRVKLHGIERAHSVTWNPHKMMGVPLQCSTIL 369

  Fly   317 VRDVMNLKSALNVNPLYLRHEHLTGVDYRHY---------GIPLSRRFRALKLWFVFRTYGIRGL 372
            |:     :..|......|..|:|...| :||         .|...|.....|||.:::..|..|.
Zfish   370 VK-----RKGLLQQCNQLCAEYLFQPD-KHYEVSYDTGDKSIQCGRHVDIFKLWLMWKAKGSEGF 428

  Fly   373 QEYIRNHMALAKKFEMLVRKDERFEVRNDVHL--------GLVCF--------RMRTGDEPNHML 421
            :..: ||  ..:..|.|..|.:|   |.|..|        ..|||        .:..|.|     
Zfish   429 ESQV-NH--CLENAEYLYYKLKR---RTDFQLVFKGKPEHSNVCFWYLPKRVQNIPLGPE----- 482

  Fly   422 LAQINHSGKMHMTPAKFNGRYV---------------IRF--CVTYEHATEKDILEAWTQIKCFA 469
                 ...::||...|...:.:               :.|  ||....||:::      .:....
Zfish   483 -----REKELHMVAPKIKTKMMEEGFTMIGYQPLEDKVNFFRCVFSNPATQRE------DVDFLL 536

  Fly   470 EEILR 474
            :||:|
Zfish   537 DEIVR 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tdc1NP_610226.2 Pyridoxal_deC 35..412 CDD:278699 101/410 (25%)
gad3NP_001083039.2 Pyridoxal_deC 96..469 CDD:278699 100/398 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.