DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and CWC27

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_015261.1 Gene:CWC27 / 856041 SGDID:S000005985 Length:301 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:32/151 - (21%)
Similarity:49/151 - (32%) Gaps:54/151 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMIQGGDFVQGD--- 89
            |..|.:..||:|...|.|.:.|..                           |:..|.|..|:   
Yeast    17 TTKGNIAIELWAKECPETCKRFLS---------------------------MLSDGTFTNGEFKE 54

  Fly    90 ---------GTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHV 145
                     ....|..|.....::|..::.:..|||     |.:.....:|||.    ..|.|||
Yeast    55 LKPTQWLMFNANSTGEYRTVAEEKNPRIRFNRDGLL-----GWDRRRNTWFITV----LADSKHV 110

  Fly   146 -----VFGRVL-DGLLIMRKI 160
                 |||::: ..:.|.|:|
Yeast   111 LNDCNVFGKIVGKSIYIFREI 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 32/151 (21%)
CWC27NP_015261.1 cyclophilin 6..167 CDD:412213 32/151 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.