DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and CPR8

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_014425.3 Gene:CPR8 / 855762 SGDID:S000005311 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:174 Identity:54/174 - (31%)
Similarity:82/174 - (47%) Gaps:25/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NNPVVFFDIAVGTTEIGRMI-FELFADTVPRTAENFRQFCTG---------EYRPDGVPIGYKGA 69
            |..:||.| ...:.|.||:| .:|:...||:|...|.|:...         .|.|:        .
Yeast    51 NIGIVFTD-PESSEEAGRLITIDLYGTMVPKTVMTFCQYVDSVKDRLASRHSYSPE--------R 106

  Fly    70 SFHRVIKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITC 134
            .|.:::.:..|:|.. |.......|.:......:||.:|.||.||.:||.   |:..|.:|.|..
Yeast   107 DFDKILPNGAIEGSS-VSSSSIEETEMLAPKLPEENHSLIHDRPGRVSMI---KDDKGLKFIIET 167

  Fly   135 AKCNFLDGKHVVFGRVLDGLL-IMRKIENVPTGPNNKPKLPVTI 177
            ::.. |:|:.||||:|..||. :|.|:.||.|..|.||:.|:||
Yeast   168 SETP-LEGESVVFGQVTAGLKDLMDKLANVKTDENGKPEQPITI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 53/172 (31%)
CPR8NP_014425.3 cyclophilin 65..210 CDD:412213 47/157 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.