DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and CPR4

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_009995.1 Gene:CPR4 / 850433 SGDID:S000000665 Length:318 Species:Saccharomyces cerevisiae


Alignment Length:165 Identity:57/165 - (34%)
Similarity:81/165 - (49%) Gaps:12/165 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYR------PDGV-PIGYKGASFHRVI 75
            :.:||....:.:...:.|||:...||:|..||.....|...      |:.: ...|:....::|.
Yeast    53 IEYFDPVSKSMKEADLTFELYGTVVPKTVNNFAMLAHGVKAVIEGKDPNDIHTYSYRKTKINKVY 117

  Fly    76 KDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITC-AKCN- 138
            .:..||||  |.....|..::||..|.||||.||||.|..|:||..|.::|..:|.||. |..| 
Yeast   118 PNKYIQGG--VVAPDVGPFTVYGPKFDDENFYLKHDRPERLAMAYFGPDSNTSEFIITTKADGNE 180

  Fly   139 FLDGKHVVFGRVLDGL-LIMRKIENVPTGPNNKPK 172
            .||||.||||::..|| .:|..|:...|....||:
Yeast   181 ELDGKSVVFGQITSGLDQLMDAIQYTETDEYGKPQ 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 57/165 (35%)
CPR4NP_009995.1 cyclophilin 67..219 CDD:238194 55/151 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.