DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and ROC7

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_200679.1 Gene:ROC7 / 835985 AraportID:AT5G58710 Length:204 Species:Arabidopsis thaliana


Alignment Length:167 Identity:83/167 - (49%)
Similarity:110/167 - (65%) Gaps:3/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGE--YRPDGVPIGYKGASFHRVIKDFMIQ 81
            |:||:.:.....||::..||..|||:|.||||..||||  ...:|..:.|||:||||:|..||:|
plant    37 VYFDVEIDGKAAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKNGKALHYKGSSFHRIIPSFMLQ 101

  Fly    82 GGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVV 146
            ||||..|:|.|..||||..|.||||.|||..||.|||||:|::|||.|||||....::|||:|||
plant   102 GGDFTHGNGMGGESIYGEKFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWLDGRHVV 166

  Fly   147 FGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            ||:|:.|:.::.|:| .....:..||..|.|...|::
plant   167 FGKVVTGMDVVYKVE-AEGNQSGTPKSKVVIVDSGEL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 82/163 (50%)
ROC7NP_200679.1 cyclophilin_ABH_like 35..200 CDD:238907 82/163 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.