DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and Pnsl5

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_196816.1 Gene:Pnsl5 / 831151 AraportID:AT5G13120 Length:259 Species:Arabidopsis thaliana


Alignment Length:181 Identity:90/181 - (49%)
Similarity:124/181 - (68%) Gaps:8/181 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QIQSQLRSSNNPVVFFDIAVGTTE---IGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYK 67
            ::.::.:|.....|:|||:||...   .||::..|:.|.||:|.||||..||||     ...|||
plant    79 EVVTEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGE-----KGFGYK 138

  Fly    68 GASFHRVIKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFI 132
            |::|||||:|||||||||.:|:|||..|:||.||.||||.|.|..||:|||||:|..|||.||||
plant   139 GSTFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGPGVLSMANAGPNTNGSQFFI 203

  Fly   133 TCAKCNFLDGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            ...|.::|||:|||||:|::|:.:::.||...|...::|:..|.|:.|||:
plant   204 CTIKTSWLDGRHVVFGQVIEGMEVVKLIEEQETDRGDRPRKKVVIADCGQL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 86/166 (52%)
Pnsl5NP_196816.1 cyclophilin_ABH_like 90..252 CDD:238907 86/166 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.