DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and AT4G34960

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_195222.1 Gene:AT4G34960 / 829648 AraportID:AT4G34960 Length:224 Species:Arabidopsis thaliana


Alignment Length:167 Identity:74/167 - (44%)
Similarity:106/167 - (63%) Gaps:2/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGE--YRPDGVPIGYKGASFHRVIKDFMIQ 81
            ||.|:.:....:||::..|:...||:|.||||..||||  ....|.|:.|||..|||:|..|:||
plant    49 VFLDVDIDGQRLGRIVIGLYGTVVPKTVENFRALCTGEKGKTSSGKPLHYKGTPFHRIISGFVIQ 113

  Fly    82 GGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVV 146
            |||.:.|||....||||.||.||||.::|...|:::|||:|.::||.|||||..|.::|:|:|||
plant   114 GGDIIHGDGKSSDSIYGGTFPDENFKIQHSHAGMVAMANTGPDSNGSQFFITTVKASWLEGEHVV 178

  Fly   147 FGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            .|:|:.|:..:..||......:.||:..|.|:..|::
plant   179 LGKVIQGMDNVFAIEGGAGTYSGKPRKKVVIADSGEI 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 73/163 (45%)
AT4G34960NP_195222.1 cyclophilin 48..213 CDD:412213 73/163 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.