DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and ROC5

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_195213.1 Gene:ROC5 / 829639 AraportID:AT4G34870 Length:172 Species:Arabidopsis thaliana


Alignment Length:171 Identity:95/171 - (55%)
Similarity:116/171 - (67%) Gaps:3/171 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPD--GVPIGYKGASFHRVIKD 77
            :||.||||:::..|.|||:..||||||.|.||||||..||||....  |.|:.:||:.|||||..
plant     2 SNPRVFFDMSLSGTPIGRIEMELFADTTPNTAENFRALCTGEKGMGKLGKPLHFKGSIFHRVIPG 66

  Fly    78 FMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDG 142
            ||.|||||...:|||..||||..|.||||..||...|:|||||||..|||.||||...|.::|||
plant    67 FMCQGGDFTAKNGTGGESIYGAKFKDENFIKKHTGAGILSMANSGPNTNGSQFFICTDKTSWLDG 131

  Fly   143 KHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            ||||||:|:.||.:::.||.|.:......|: |||:.|||:
plant   132 KHVVFGQVVKGLDVVKAIEKVGSDSGKTSKV-VTITDCGQL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 91/165 (55%)
ROC5NP_195213.1 cyclophilin_ABH_like 4..169 CDD:238907 91/165 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.