DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and ROC4

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001154684.1 Gene:ROC4 / 825376 AraportID:AT3G62030 Length:313 Species:Arabidopsis thaliana


Alignment Length:177 Identity:92/177 - (51%)
Similarity:122/177 - (68%) Gaps:7/177 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IQSQLRSSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASF 71
            |:.|.:.:|.  |:||:.:|....||::..||.:.||:|.||||..||||.:     .||||:||
plant   140 IEPQAKVTNK--VYFDVEIGGEVAGRIVMGLFGEVVPKTVENFRALCTGEKK-----YGYKGSSF 197

  Fly    72 HRVIKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAK 136
            ||:|||||||||||.:|:|||..||||..|.||||||||..||:|||||:|..|||.||||...|
plant   198 HRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTVK 262

  Fly   137 CNFLDGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            .::||.||||||:|::|:.::|.:|:..|...:.||....|..||::
plant   263 TSWLDNKHVVFGQVIEGMKLVRTLESQETRAFDVPKKGCRIYACGEL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 87/163 (53%)
ROC4NP_001154684.1 cyclophilin_ABH_like 149..307 CDD:238907 87/164 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.