DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and AT3G55920

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_567029.1 Gene:AT3G55920 / 824758 AraportID:AT3G55920 Length:228 Species:Arabidopsis thaliana


Alignment Length:181 Identity:92/181 - (50%)
Similarity:118/181 - (65%) Gaps:4/181 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NQIQSQLRSSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPD--GVPIGYK 67
            ||:...|....:. |:|||.:..:..||::..||.:.||:||||||..||||....  |.|:.:|
plant    48 NQVGEDLEGVTHK-VYFDIQINGSPAGRILIGLFGNIVPKTAENFRSLCTGEKGVGNMGKPLYFK 111

  Fly    68 GASFHRVIKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFI 132
            |:||||:|..||||||||.:|||.|..||||:.|.||||.|||..||.|||||||.::||.||||
plant   112 GSSFHRIIPGFMIQGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGFLSMANSGPDSNGSQFFI 176

  Fly   133 TCAKCNFLDGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            |....::|||.|||||:||.|:.::|||| .....:..||..|.|...|::
plant   177 TTVTTSWLDGHHVVFGKVLSGMEVVRKIE-AQGQDSGVPKANVIIFASGEV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 88/165 (53%)
AT3G55920NP_567029.1 cyclophilin_ABH_like 59..224 CDD:238907 88/166 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.