DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and AT3G22920

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_188932.1 Gene:AT3G22920 / 821864 AraportID:AT3G22920 Length:232 Species:Arabidopsis thaliana


Alignment Length:173 Identity:77/173 - (44%)
Similarity:98/173 - (56%) Gaps:13/173 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGE--YRPDGVPIGYKGASFHRVIKDF 78
            ||.||||:.|.....||::.|||||..||||||||..||||  ....|.||.|||::|..::.|.
plant     3 NPKVFFDLTVDGKPAGRIVIELFADLTPRTAENFRGLCTGERGIGKCGKPIHYKGSTFDHIVPDL 67

  Fly    79 MIQGGDFVQGDGTGVTSIYGNTFGDENFTLKH-DSPGLLSMANSGKETNGCQFFITCAKCNF-LD 141
            |..|||.:..:    ..|:.....||.|.|.| |.||::|||:|    ||.||.|....... :|
plant    68 MWCGGDIIFEN----EPIHSEELDDEYFILNHEDGPGIISMADS----NGSQFQIHMKDYGLQVD 124

  Fly   142 GKHVVFGRVLDGLLIMRKIE-NVPTGPNNKPKLPVTISQCGQM 183
            |.|||.|:|::||.:||.|| .|.|.....|..||.|:.||::
plant   125 GDHVVIGKVVEGLDLMRNIEKEVITTTTRTPSKPVVIADCGEL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 74/168 (44%)
AT3G22920NP_188932.1 cyclophilin 1..168 CDD:381853 77/173 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.