DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and SQN

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_565381.1 Gene:SQN / 816074 AraportID:AT2G15790 Length:361 Species:Arabidopsis thaliana


Alignment Length:167 Identity:94/167 - (56%)
Similarity:113/167 - (67%) Gaps:3/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGE--YRPD-GVPIGYKGASFHRVIKDFMIQ 81
            |.||::|....||::.||:.|.||:||||||..||||  ..|: |||:.|||..||||||.||||
plant     7 FMDISIGGELEGRIVIELYDDVVPKTAENFRLLCTGEKGLGPNTGVPLHYKGNRFHRVIKGFMIQ 71

  Fly    82 GGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVV 146
            |||....||||..||||..|.||||.|||:..|:|||||||..|||.|||||..:.:.|||||||
plant    72 GGDISANDGTGGESIYGLKFDDENFELKHERKGMLSMANSGPNTNGSQFFITTTRTSHLDGKHVV 136

  Fly   147 FGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            ||||..|:.::|.||:|.....:.|...|.|..||::
plant   137 FGRVTKGMGVVRSIEHVSIEEQSCPSQDVVIHDCGEI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 92/163 (56%)
SQNNP_565381.1 cyclophilin_ABH_like 4..171 CDD:238907 92/163 (56%)
TPR_11 216..329 CDD:290150
TPR repeat 263..293 CDD:276809
TPR_2 298..331 CDD:285020
TPR repeat 298..326 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.