DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and Ppil6

DIOPT Version :10

Sequence 1:NP_610224.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_082706.1 Gene:Ppil6 / 73075 MGIID:1920325 Length:313 Species:Mus musculus


Alignment Length:173 Identity:75/173 - (43%)
Similarity:109/173 - (63%) Gaps:3/173 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LRSSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGE--YRPDGVPIGYKGASFHR 73
            |:.:.:..|:.||.:..:.|||:||||:.|..|||..||:..|||.  :...|..:.||.:.|||
Mouse   138 LKDTKHDFVYLDICIDLSPIGRLIFELYCDACPRTCTNFQVLCTGTSGFSERGTKLHYKDSIFHR 202

  Fly    74 VIKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCN 138
            |:::..|||||.|||.|....||||.||.||||::.|:..|:|.|.|.|..|||.||:||.....
Mouse   203 VVQNGWIQGGDIVQGRGDDGESIYGPTFEDENFSIPHNKRGVLGMVNKGHHTNGSQFYITLQAAP 267

  Fly   139 FLDGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCG 181
            :||.|:|.||::::|..:::::|.||| .|.:|.|..:|:..|
Mouse   268 YLDKKYVAFGQLIEGTHVLKQLELVPT-ENERPLLLCSIADSG 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_610224.1 cyclophilin_ABH_like 17..181 CDD:238907 73/165 (44%)
Ppil6NP_082706.1 cyclophilin 146..309 CDD:469651 73/163 (45%)

Return to query results.
Submit another query.