DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and Ppil1

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_081121.1 Gene:Ppil1 / 68816 MGIID:1916066 Length:166 Species:Mus musculus


Alignment Length:156 Identity:65/156 - (41%)
Similarity:90/156 - (57%) Gaps:15/156 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMIQ 81
            |.|:.:     |.:|.::.||:....|:|.:||.:.....|        |.|..|||:|||||||
Mouse    12 PNVYLE-----TSMGVIVLELYWKHAPKTCKNFAELARRGY--------YNGTKFHRIIKDFMIQ 63

  Fly    82 GGDFVQGDGTGVTSIYGNTFGDE-NFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHV 145
            ||| ..|.|.|..||||..|.|| :..||....|:|:|||:|.:|||.|||:|.|...:|||||.
Mouse    64 GGD-PTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHT 127

  Fly   146 VFGRVLDGLLIMRKIENVPTGPNNKP 171
            :||||..|:.::.::..|.|...::|
Mouse   128 IFGRVCQGIGMVNRVGMVETNSQDRP 153

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 65/156 (42%)
Ppil1NP_081121.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 63/153 (41%)
Cyclosporin A binding. /evidence=ECO:0000250 54..65 9/10 (90%)