DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and Ppil6

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:XP_017457315.1 Gene:Ppil6 / 685567 RGDID:1592581 Length:332 Species:Rattus norvegicus


Alignment Length:149 Identity:68/149 - (45%)
Similarity:92/149 - (61%) Gaps:4/149 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LRSSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGE--YRPDGVPIGYKGASFHR 73
            |:.:.:..||.||::....|||:||||:.|..|||..||:..|||.  :...|:.:.||.:.|||
  Rat   138 LKDTKHDFVFLDISIDLAPIGRLIFELYCDACPRTCTNFQVLCTGTSGFSERGIKLHYKDSIFHR 202

  Fly    74 VIKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCN 138
            |:|:..:||||.|:|.|....||||.||.||||::.|:..|:|.|.|.|..|||.||:||.....
  Rat   203 VVKNGWVQGGDIVEGRGDDGESIYGPTFEDENFSVPHNKRGVLGMVNKGHHTNGSQFYITLQATP 267

  Fly   139 FLDGKHVVFGRVLDGLLIM 157
            :||.|:|.||  |..:|.|
  Rat   268 YLDKKYVAFG--LHSILYM 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 67/143 (47%)
Ppil6XP_017457315.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.