DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and Ppil4

DIOPT Version :10

Sequence 1:NP_610224.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_080417.2 Gene:Ppil4 / 67418 MGIID:1914668 Length:492 Species:Mus musculus


Alignment Length:142 Identity:51/142 - (35%)
Similarity:77/142 - (54%) Gaps:18/142 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMIQGGDFVQGDGTG 92
            |.:|.::.:|:.:..||...||.:.|..:|        |.....|.|.:||:||.|| ..|.|.|
Mouse     7 TTLGDVVIDLYTEERPRACLNFLKLCKIKY--------YNYCLIHNVQRDFIIQTGD-PTGTGRG 62

  Fly    93 VTSIYGNTFGDE-NF-------TLKHDSPGLLSMANSGKETNGCQFFITCAK-CNFLDGKHVVFG 148
            ..||:|..:||: :|       .:||...|.:||.|:|.:.:|.||.||..: .::|||.|.|||
Mouse    63 GESIFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFG 127

  Fly   149 RVLDGLLIMRKI 160
            .|.:|:.|::||
Mouse   128 EVTEGMDIVKKI 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_610224.1 cyclophilin_ABH_like 17..181 CDD:238907 51/142 (36%)
Ppil4NP_080417.2 cyclophilin_RRM 4..161 CDD:238902 51/142 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..188
RRM_PPIL4 237..319 CDD:409681
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..409
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 423..492
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.