DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and Ppib

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_071981.1 Gene:Ppib / 64367 RGDID:620312 Length:208 Species:Rattus norvegicus


Alignment Length:165 Identity:93/165 - (56%)
Similarity:115/165 - (69%) Gaps:5/165 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMIQGG 83
            |:||..:|...:||:.|.||..|||:|.:||....|||     ...|||.:.|||||||||||||
  Rat    38 VYFDFQIGDEPVGRVTFGLFGKTVPKTVDNFVALATGE-----KGFGYKNSKFHRVIKDFMIQGG 97

  Fly    84 DFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVVFG 148
            ||.:|||||..||||..|.||||.|||..||.:||||:||:|||.|||||..|.::|||||||||
  Rat    98 DFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTSWLDGKHVVFG 162

  Fly   149 RVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            :||:|:.::||:||..|...:||...|.|..||::
  Rat   163 KVLEGMDVVRKVENTKTDSRDKPLKDVIIVDCGKI 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 91/161 (57%)
PpibNP_071981.1 cyclophilin_ABH_like 37..195 CDD:238907 91/161 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.