DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and ppih

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_957499.1 Gene:ppih / 494165 ZFINID:ZDB-GENE-040625-127 Length:181 Species:Danio rerio


Alignment Length:154 Identity:113/154 - (73%)
Similarity:131/154 - (85%) Gaps:0/154 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QLRSSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRV 74
            |..:.|||:||||:::|..|:|||..|||||.||:||||||||||||::.||||:||||.:||||
Zfish     4 QPSNPNNPIVFFDVSIGGQEVGRMKIELFADIVPKTAENFRQFCTGEFKKDGVPVGYKGCTFHRV 68

  Fly    75 IKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNF 139
            ||||||||||||.|||||:.|||...|.||||.:||..||||||||||..||||||||||.||::
Zfish    69 IKDFMIQGGDFVNGDGTGICSIYRGPFADENFRMKHSGPGLLSMANSGPGTNGCQFFITCTKCDW 133

  Fly   140 LDGKHVVFGRVLDGLLIMRKIENV 163
            |||||||||:|:||||:|||||.|
Zfish   134 LDGKHVVFGKVVDGLLVMRKIEAV 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 110/147 (75%)
ppihNP_957499.1 cyclophilin_ABH_like 11..175 CDD:238907 110/147 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575147
Domainoid 1 1.000 256 1.000 Domainoid score I1996
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38172
Inparanoid 1 1.050 282 1.000 Inparanoid score I2860
OMA 1 1.010 - - QHG54618
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0005876
OrthoInspector 1 1.000 - - oto38688
orthoMCL 1 0.900 - - OOG6_103291
Panther 1 1.100 - - LDO PTHR11071
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R962
SonicParanoid 1 1.000 - - X4270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.900

Return to query results.
Submit another query.