DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and Moca-cyp

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster


Alignment Length:174 Identity:91/174 - (52%)
Similarity:116/174 - (66%) Gaps:5/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIG----YKGASFHRV 74
            :..|..||||::|...:||::||||.|..|:||||||..|||| :..|:..|    |||..||||
  Fly    10 ATRPRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGE-KGFGLITGKKLQYKGVIFHRV 73

  Fly    75 IKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNF 139
            :||||:|.|||..|:|||..||||.||.||:|..|||.|.||||||.||.|||.|||||......
  Fly    74 VKDFMVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPH 138

  Fly   140 LDGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            ||..|||||:|:.|..::|::|.:|...|::|.....|:.||::
  Fly   139 LDNIHVVFGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGEL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 89/167 (53%)
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 89/167 (53%)
SH3-RhoG_link 635..>718 CDD:293215
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447246
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.