DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and CG5808

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster


Alignment Length:160 Identity:49/160 - (30%)
Similarity:76/160 - (47%) Gaps:18/160 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMIQGGDFVQGDGTG 92
            |.:|.:..:||....|....||.:.|..:|        |....||.|.:.|:.|.|| ..|.|.|
  Fly     7 TTMGDLTVDLFISERPIACLNFLKLCRLKY--------YNFNLFHTVQQGFIAQTGD-PSGAGDG 62

  Fly    93 VTSIYG------NTFGDENF--TLKHDSPGLLSMANSGKETNGCQFFITCAK-CNFLDGKHVVFG 148
            .:||:|      ..|.:..|  .:.|.|.|:||:.::||...|.|||:|..: ...|||.|.|.|
  Fly    63 GSSIWGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIG 127

  Fly   149 RVLDGLLIMRKIENVPTGPNNKPKLPVTIS 178
            .|::|..::||:.:.....:.:|...:.|:
  Fly   128 EVVEGHEVLRKLNDAIVDDSFRPYQDIRIT 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 49/160 (31%)
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 49/160 (31%)
RRM <237..445 CDD:223796
RRM_PPIL4 237..319 CDD:240681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447239
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.