DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and ppid

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001002065.1 Gene:ppid / 415155 ZFINID:ZDB-GENE-040625-34 Length:371 Species:Danio rerio


Alignment Length:173 Identity:95/173 - (54%)
Similarity:121/173 - (69%) Gaps:4/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEY---RPDGVPIGYKGASFHRV 74
            ::.||.||||:.:|...:||::||||||.||:||||||..||||.   :..|.|:.:||..|||:
Zfish    12 NAENPRVFFDVEIGAERVGRVVFELFADVVPKTAENFRALCTGEKGVGKSTGKPLHFKGCPFHRI 76

  Fly    75 IKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNF 139
            ||.||||||||...:|||..||||:.|.||||..|||..|||||||:|..|||.|||||......
Zfish    77 IKSFMIQGGDFSNQNGTGGESIYGDKFEDENFHYKHDREGLLSMANAGPNTNGSQFFITTVPTPH 141

  Fly   140 LDGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQ 182
            |||||||||:||.|:.:::.:|.:.|..:| |..|..|::||:
Zfish   142 LDGKHVVFGQVLKGMGVVKMLEAMETKEDN-PVKPCVIAECGE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 92/166 (55%)
ppidNP_001002065.1 cyclophilin_ABH_like 16..182 CDD:238907 92/166 (55%)
TPR_11 223..304 CDD:290150
TPR repeat 223..268 CDD:276809
TPR_12 271..340 CDD:290160
TPR repeat 273..303 CDD:276809
TPR repeat 308..336 CDD:276809
TPR_1 309..341 CDD:278916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.