DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and ppib

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_998184.1 Gene:ppib / 406292 ZFINID:ZDB-GENE-040426-1955 Length:216 Species:Danio rerio


Alignment Length:165 Identity:94/165 - (56%)
Similarity:117/165 - (70%) Gaps:5/165 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMIQGG 83
            |:|||.:|..:.||::..||..|||:|.|||.|..|||     ...||||:.|||||||||||||
Zfish    46 VYFDIKIGDEDAGRIVIGLFGKTVPKTTENFLQLATGE-----KGFGYKGSKFHRVIKDFMIQGG 105

  Fly    84 DFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVVFG 148
            ||.:|||||..||||:.|.||||.|||..||.|||||:||:|||.|||||..:..:|||||||||
Zfish   106 DFTRGDGTGGKSIYGDRFPDENFKLKHYGPGWLSMANAGKDTNGSQFFITTVQTPWLDGKHVVFG 170

  Fly   149 RVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            ::|:|:.::||||...|...:||...|:|...|::
Zfish   171 KILEGMDVVRKIEATKTDGRDKPLKDVSIHDSGKI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 93/161 (58%)
ppibNP_998184.1 cyclophilin_ABH_like 45..203 CDD:238907 93/161 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.